PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400007292
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 219aa    MW: 25577 Da    PI: 9.7717
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400007292genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.69.1e-30958150
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                          krienk+nrqvtfskRr g+lKKA+E+SvLCdaev +i+fs++gkl+ey+
  PGSC0003DMP400007292  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYA 58
                          79***********************************************8 PP

2K-box102.84.5e-348417410100
                 K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                           +++   s++ e+akLk+++e Lqr+q+h++GedLesL++keLq+Le+qL+++lk+iRs+Kn+l++e+i+ lqk+ ++lqe+n++L+kk+
  PGSC0003DMP400007292  84 DHTSPGSWTLEHAKLKARLEVLQRNQKHYVGEDLESLNMKELQNLEHQLDSALKHIRSRKNQLMHESISVLQKQDRALQEQNNQLSKKV 172
                           5666789*********************************************************************************9 PP

                 K-box  99 ee 100
                           +e
  PGSC0003DMP400007292 173 KE 174
                           86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.001161IPR002100Transcription factor, MADS-box
CDDcd002655.02E-41274No hitNo description
SuperFamilySSF554553.92E-33288IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-31323IPR002100Transcription factor, MADS-box
PfamPF003195.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.0E-2886172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.22188178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVGLIVFST KGKLFEYAND  60
SCMERLLERY ERYSFAERQL VPTDHTSPGS WTLEHAKLKA RLEVLQRNQK HYVGEDLESL  120
NMKELQNLEH QLDSALKHIR SRKNQLMHES ISVLQKQDRA LQEQNNQLSK KVKEREKEVA  180
QQNQWDQQNH EINSSTFVLP QQLDSPHLGY TPNFLVFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S6e-22174173Myocyte-specific enhancer factor 2B
1tqe_R6e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q6e-22174173Myocyte-specific enhancer factor 2B
1tqe_P6e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankSTU237580.0U23758.1 Solanum tuberosum transcription factor (POTM1-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275142.11e-153agamous-like MADS-box protein AGL8 homolog
SwissprotQ424291e-155AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLM0ZY311e-161M0ZY31_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000104511e-152(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-100AGAMOUS-like 8
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]